Alexa top domain list

RankWebsite URLCategory
#170001 wannabees.com.au
#170002 educon.by
#170003 iotfig.com
#170004 appdirectory.online
#170005 valejet.com
#170006 sportskacentrala.com
#170007 mya5.ru
#170008 goodtechtricks.com
#170009 bandwidth.com
#170010 getdigitalservices.com
#170011 p2p4u.tv
#170012 chemaxon.com
#170013 platy.com
#170014 ehs.com
#170015 haliva.com
#170016 gremialesdelsur.com.ar
#170017 myintextual.net
#170018 servoingenieria.com.ar
#170019 sydbank.dk Banks
#170020 xn--decorandouas-jhb.net
#170021 putlockers.ws
#170022 posturl.esy.es
#170023 uchebniki-online.net
#170024 postavshhiki.ru
#170025 aosholding.com
#170026 buyitworth.com Online Shopping
#170027 hobbydigi.com
#170028 magnetoteam.com
#170029 mmmi4.xyz
#170030 print100.com
#170031 rayluicentre.com
#170032 ruggedvid.com
#170033 shoplazza.com Online Shopping
#170034 welabts.net
#170035 carmasters.org
#170036 colombotelegraph.com
#170037 arabi-online.net
#170038 forms.app
#170039 dineanddish.net
#170040 my-question.ru
#170041 javnew.net
#170042 wseetk.com
#170043 hostingsprout.com Domains & Hosting
#170044 laugarnecaravans.ning.com
#170045 tixati.com
#170046 clinicabaviera.com
#170047 bizeducator.com Education
#170048 fapvid.vip
#170049 gholgholahotel.com Hotels, Resorts & Food
#170050 sarafi.af
#170051 sex0098.com Adult
#170052 watan24.com
#170053 xtvlink.com
#170054 mothercare.com.sa
#170055 gayguysfilm.com
#170056 nafiun.com
#170057 calmradio.com
#170058 javanews.al News
#170059 enjoy-job.ru Jobs
#170060 seeclickfix.com
#170061 oshcallianzassistance.com.au
#170062 ukshare.net
#170063 freeletics.com
#170064 cmbeb5visa.com
#170065 umh.es
#170066 cuilahore.edu.pk
#170067 ksestocks.com
#170068 vistaequitypartners.com
#170069 ihb.ir
#170070 salongardi.com
#170071 thedieline.com
#170072 aminaramesh.ir
#170073 makhsoom.com
#170074 recetasdelabuela.es
#170075 tubecorporate.com Videos
#170076 hduporn.com Adult
#170077 evitamins.com
#170078 thesaneadventurer.com
#170079 assh.org
#170080 2ndwatch.com
#170081 appreviewdesk.com
#170082 broadsoft.com
#170083 chanceloves.com
#170084 christopherandbanks.com Banks
#170085 cnu.edu
#170086 ddn.com
#170087 dt-global.com
#170088 electroluxappliances.com
#170089 exin.nl
#170090 fairwinds.com
#170091 freeloadr.com
#170092 getransportation.com
#170093 inoacusa.com
#170094 ju.edu
#170095 knightfloors.com
#170096 mdigital-my.sharepoint.com
#170097 moneyqanda.com
#170098 motherrisingbirth.com
#170099 picmaker.com
#170100 rosedalejewelry.com
#170101 siftrock.com
#170102 thetelugufilmnagar.com
#170103 tooltip.io
#170104 vanishingincmagic.com
#170105 vevent.com
#170106 wphoot.com
#170107 yashrajfilms.com
#170108 ntu.edu.pk
#170109 pseb.org.pk
#170110 guerlain.com
#170111 webcomics.co.id
#170112 simpledoc.ru
#170113 iglesia.net
#170114 amazonsellerslawyer.com
#170115 avfay.com
#170116 buona.com
#170117 mhdw.org
#170118 torontovka.com
#170119 bbntimes.com
#170120 mbrazas.com
#170121 istiklal.com.tr
#170122 hdsieunhanh.com
#170123 layandrama.me
#170124 selipan.com
#170125 singlegrain.com
#170126 abes.fr
#170127 liflandaffiliates.com
#170128 ardanlabs.com
#170129 atyourbusiness.com
#170130 biztechcs.com
#170131 blueskyresumes.com
#170132 caleres.com
#170133 destinypedia.com
#170134 distinctiveweb.com
#170135 epsnews.com News
#170136 factmyth.com
#170137 fantasyfootballers.org
#170138 feedback.wix.com
#170139 idealistcareers.org
#170140 mcvsd.org
#170141 ntv.ca
#170142 nutraingredients.com
#170143 oeis.org
#170144 ourtasteforlife.com
#170145 oyax.com
#170146 picbackman.com
#170147 pickuplinesgalore.com
#170148 python-textbok.readthedocs.io
#170149 pythontips.com
#170150 reactgo.com
#170151 religionnews.com News
#170152 reviewhell.com
#170153 rooshvforum.com
#170154 siimland.com
#170155 solostream.com
#170156 spicegoddess.co.za
#170157 stelly.com.au
#170158 tchspt.com
#170159 thezebra.com
#170160 uscho.com
#170161 uswatersystems.com
#170162 wowfreebies.com
#170163 santesoft.com
#170164 santesoft.eu
#170165 oguzakkus.com
#170166 sexanimalvideos.com Adult
#170167 abtach.com
#170168 bankislami.com.pk Banks
#170169 ibexglobal.com
#170170 baigoogledu.com Search Engines
#170171 childrensfactory.com
#170172 phayao2.go.th
#170173 surinarea1.go.th
#170174 bstyle.vn
#170175 hust.edu.vn
#170176 phanphoinhanh.com
#170177 tinxe.vn
#170178 vimaru.edu.vn
#170179 tutu.market
#170180 kinotut.info
#170181 hay.dk
#170182 unisys.com
#170183 alborzcenter.com
#170184 citysazeh.com
#170185 peeyade.com
#170186 tv-newtabsearch.com
#170187 tulp.ru
#170188 freefilesync.org
#170189 kemdetki.ru
#170190 sandsprecision.com
#170191 zoodroom.com
#170192 lunn.ru
#170193 siouxcityjournal.com
#170194 amurobl.ru
#170195 my-files.ru
#170196 freeabc.xyz
#170197 solarmovie.ink
#170198 getvideoconvert.com Videos
#170199 phonebooky.com
#170200 101dizain.ru
#170201 tvseries-download.com
#170202 nalogobzor.info
#170203 blaauwberg.net
#170204 pakyudi.com
#170205 a34z.com
#170206 cloudwebxspeed.com
#170207 desikahani2.net
#170208 freshers9.com
#170209 hitasoft.in
#170210 neobacklinks.com
#170211 numberwale.com
#170212 paramhomes.com
#170213 peso.gov.in government Related
#170214 prolearnings.com
#170215 pustakindia.com
#170216 techbriefers.com
#170217 trilyo.com
#170218 wefornews.com News
#170219 whed.net
#170220 newsaddicted.online News
#170221 dvdgayonline.com
#170222 faucet-ltc.xyz
#170223 freebitking.com
#170224 quem-chamou.com
#170225 lifeinsys.com
#170226 meloads.com
#170227 mailoptin.io Email Provider
#170228 dishtvbiz.in
#170229 bdl.dz
#170230 bloggif.com Blogs
#170231 wonderfly.asia
#170232 thefastmode.com
#170233 heysuccess.com
#170234 sat.kharkiv.ua
#170235 kellycodetectors.com
#170236 vsrf.ru
#170237 ckm.pl
#170238 freezlike.com
#170239 comments.app
#170240 dailyclicks.net
#170241 ferousis.gr
#170242 gatzelis-shoes.gr
#170243 hellenicnwes.blogspot.com Blogs
#170244 paokmania.gr
#170245 shortently.com
#170246 t-zine.gr
#170247 special-edu.kz
#170248 iosandr0.com
#170249 turkdilbilgisi.com
#170250 netref.ru
#170251 intently.co
#170252 mynimo.com
#170253 mercateo.com
#170254 piter.tv
#170255 markukule.mk
#170256 pharmacia1.com
#170257 zonahdpro.com
#170258 kikuu.com.gh
#170259 kopikot.ru
#170260 5000bc.com
#170261 elpregonar.co
#170262 paidforarticles.com
#170263 ababank.com Banks
#170264 pornotravestis.xxx Adult
#170265 eldesgraciadodigital.com
#170266 notigraficas.com
#170267 allkey.org
#170268 qualityresearchinternational.c
#170269 flashplayer.ru
#170270 123moviesnet.org
#170271 varroclighting.com
#170272 phptravels.net Tours & Travels
#170273 jakearchibald.github.io
#170274 apruve.com
#170275 chemicalsafetyfacts.org
#170276 edi-uae.com
#170277 moviegasm.com
#170278 ethicaljobs.com.au Jobs
#170279 wordsolver.net
#170280 biografiku.com
#170281 teensxxxtube.com Adult
#170282 widget-options.com
#170283 tits-guru.com
#170284 niagahoster.com
#170285 artpreset.ru
#170286 fitnessrepublic.com
#170287 core4switch.net
#170288 fmoviez.org
#170289 farfshaa.com
#170290 monolith.in.ua
#170291 boba.com
#170292 somosguate.com
#170293 btc-miner.online
#170294 aegis-client.azurewebsites.net
#170295 amy-j-lee.com
#170296 antiqueposters.com
#170297 apdepot.com
#170298 arata-law.com
#170299 beaverdamwoodworks.com
#170300 bernieandphyls.com
#170301 bernieportal.com
#170302 blink.mortgage
#170303 borosilicatejars.myshopify.com Online Shopping
#170304 boulderrunningcamps.com
#170305 camabi.net
#170306 caswellmessenger.com
#170307 chicago-candle-factory.myshopi Online Shopping
#170308 coastal-scents.myshopify.com Online Shopping
#170309 collegepressbox.com Education
#170310 dadpatrol.com
#170311 dev-themuse-employers.pantheon
#170312 dollhousedecoratingblog.com Blogs
#170313 dreamlighttech.myshopify.com Online Shopping
#170314 drglowgetter.com
#170315 engagepeopleops.com
#170316 farmsteadapp.com
#170317 fitnessgenes.com
#170318 form4oracle.com
#170319 frichti.co
#170320 gallitin.com
#170321 gckschools.com Education
#170322 holdup-suspender-company.mysho Online Shopping
#170323 huntsville-isd.org
#170324 infiore.net
#170325 innovadatabase.com
#170326 itrucker.com
#170327 janelabay.com
#170328 justfolio.com
#170329 latitude38.com
#170330 lawlessbeauty.com
#170331 lifterlms.com
#170332 lincolnshirefieldscc.com
#170333 lunarcrush.com
#170334 lvemagazine.com
#170335 magnitude.io
#170336 manewigs-com.myshopify.com Online Shopping
#170337 marthapullen.com
#170338 mdcreekmore.com
#170339 mersintime.com
#170340 myherbology.com
#170341 mywowbb.com
#170342 newageincense.com
#170343 nsetap.com
#170344 nymamababa.com
#170345 offerarmy.com
#170346 originalautoperformance.com
#170347 osmotics.com
#170348 pasty.com
#170349 pipware.net
#170350 pixsystem.com
#170351 platinumpayxpress.com
#170352 powereqp.com
#170353 ppoc.club
#170354 previewsitesmediasmacksiteserv
#170355 redlineeuropean.com
#170356 redragonshop.com Online Shopping
#170357 revistaequipar.com
#170358 roadraceautox.com
#170359 royce-lingerie.co.uk
#170360 schimiggy.com
#170361 sharpcalculators.com
#170362 shqipopedia.org
#170363 smoke-and-vape.myshopify.com Online Shopping
#170364 socialr.com
#170365 sonitekstore.com
#170366 sportyshow.com
#170367 staq-infra.com
#170368 superpill.myshopify.com Online Shopping
#170369 talking-time.net
#170370 taskmanagementsystem.herokuapp
#170371 texturewood.com
#170372 thebellacocina.com
#170373 themusicstand.com
#170374 tigerphones.com
#170375 torahchicago.org
#170376 trafficbuilders.us
#170377 unlimitedvacationclub.com
#170378 urbanartassociation.com
#170379 valic.com
#170380 wcad.org
#170381 weathermakers.com
#170382 wipfilms.net
#170383 woven.is
#170384 yonexusa.com
#170385 allforfashiondesign.com
#170386 greentumble.com
#170387 fujifilm.ca
#170388 moneyshow.com
#170389 xiepp.com
#170390 bluesystem.info
#170391 galaxymacau.com
#170392 gong.io
#170393 4rkinggame.com
#170394 futabus.vn
#170395 sotis-online.ru
#170396 hostpk.website
#170397 brainkart.com
#170398 onlinevisas.com
#170399 remotecentral.com
#170400 flytographer.com
#170401 360d.com.tw
#170402 avilas-style.com
#170403 bluezz.tw
#170404 chip123.com.tw
#170405 freehoro.net
#170406 tuhaoxs.com
#170407 twh5fun.com
#170408 auphonic.com
#170409 kimandkalee.com
#170410 sonlifetv.com
#170411 mauritiusturfclub.com
#170412 winenco.com
#170413 classon.ru
#170414 clk.sh
#170415 collectoffers.com
#170416 c300.me
#170417 diobuch.ru
#170418 klubnayaliga.ru
#170419 mestopolozhenie-telefona.ru
#170420 ser-esenin.ru
#170421 soshinenie.ru
#170422 whatsapped.ru
#170423 xn---38-5cdaqnz3edbjncp.xn--p1
#170424 zapozdravleniem.ru
#170425 itempurl.com
#170426 signeasy.com
#170427 sultan-center.com
#170428 getvera.com
#170429 ensayoscortos.com
#170430 profamilia.org.co
#170431 pornado.co Adult
#170432 livescore18.com
#170433 immiproaustralia.com.au
#170434 babysleepmiracle.com
#170435 tmlewin.com.au
#170436 entagia.com
#170437 pinoydictionary.com
#170438 hindimovies.to
#170439 navitel.ru
#170440 nkzu.kz
#170441 assess.com
#170442 resumeviking.com
#170443 7news.az News
#170444 agbank.az Banks
#170445 aktual.az
#170446 albali.az
#170447 amu.edu.az
#170448 anaveusaq.az
#170449 ask.gov.az government Related
#170450 avrasiya.net
#170451 azerfon.az
#170452 azkurs.org
#170453 azn.az
#170454 azpost.info
#170455 azseks.net
#170456 beyaz.az
#170457 bfb.az
#170458 bildirchin.az
#170459 biq.az
#170460 bravosupermarket.az
#170461 cirtdan.tv
#170462 coca-cola.az
#170463 cumhuriyyet.net
#170464 e-sosial.az
#170465 e-tabib.com
#170466 eastnews.org News
#170467 echo.az
#170468 eduonline.az
#170469 fitret.az
#170470 gamebookers10002.com
#170471 ganjanews.az News
#170472 gencol.az
#170473 gersotravel.com Tours & Travels
#170474 gununsesi.org
#170475 herbirehberler.blogspot.com Blogs
#170476 hg-riyaziyyat-alemi.blogspot.c Blogs
#170477 hr-az.com
#170478 imho.az
#170479 ioloo.ru
#170480 joy.az
#170481 kesrler5.blogspot.com Blogs
#170482 kitabevim.az
#170483 lawreform.az
#170484 medeniyyet.az
#170485 meyxana.net
#170486 pharma.az
#170487 postbaku.biz
#170488 premiumbank.az Banks
#170489 qlobal.az
#170490 riyaziyyatportali.blogspot.com Blogs
#170491 seditiocms.com
#170492 shaurma.az
#170493 sherg.az
#170494 sosial.gov.az government Related
#170495 swtravel.az Tours & Travels
#170496 tnmparts.com
#170497 yuxuyozmalari.blogspot.com Blogs
#170498 nekto.me
#170499 horoscoponegro.com
#170500 dvidshub.net
#170501 agahitime.com
#170502 ahoota.com
#170503 bokhariha.com
#170504 saghybux.com
#170505 samfuni.com
#170506 cosmeticsinfo.org
#170507 pse.com.ph
#170508 arkenea.com
#170509 theworldbeast.com
#170510 autozel.com
#170511 leprechaun.land
#170512 3dsol.su
#170513 aup.edu
#170514 avtoustam.com
#170515 bagone.ru
#170516 literature.az
#170517 mp3musiqim.com
#170518 vd-indesign.ru
#170519 hofbraeuhaus.de
#170520 storelammoc.vn
#170521 lightpollutionmap.info
#170522 morioh.com
#170523 eljoker18.blogspot.com Blogs
#170524 truckszilla.com
#170525 weddingstats.org
#170526 doodoo.ru
#170527 rbi.com
#170528 dainikpurbokone.net
#170529 juniv.edu
#170530 clipbucket.com
#170531 brandpacks.com
#170532 cardshure.com
#170533 legitroom.com
#170534 techawk.com.ng
#170535 waeconline.org.ng
#170536 paqui.com
#170537 ccsp.ir
#170538 daneshyari.com
#170539 ghbook.ir
#170540 iranpatogh.ir
#170541 parsianhost.com
#170542 persiandogecoin.com
#170543 tech-news.ir News
#170544 traderha.com
#170545 tv4.ir
#170546 weboperator.ir
#170547 smashop.jp Online Shopping
#170548 techwikies.com
#170549 afex.com
#170550 allaboutprayer.org
#170551 arrowheadaddict.com
#170552 billypenn.com
#170553 cdm.link
#170554 certifiedangusbeef.com
#170555 corteva.com
#170556 dailycal.org
#170557 firstinarchitecture.co.uk
#170558 getholistichealth.com
#170559 gritdaily.com
#170560 iamsober.com
#170561 informationsecuritybuzz.com
#170562 instabill.com
#170563 itswapshop.com Online Shopping
#170564 kissanime.ru.com
#170565 numbergenerator.org
#170566 presstelegram.com
#170567 rascalrides.com
#170568 rvpartscountry.com
#170569 scriptlance.com
#170570 skincare.com
#170571 smartsweets.com
#170572 stopbullying.gov government Related
#170573 taxprof.typepad.com
#170574 tcbmag.com
#170575 tesd.net
#170576 usasurveyjobboard.com Jobs
#170577 uxmatters.com
#170578 wholefoodsmagazine.com
#170579 englishtochka.ru
#170580 armynow.net
#170581 epsath.gr
#170582 ergazomenos.gr
#170583 foninews.gr News
#170584 goldmall.gr
#170585 koinoniki.gr
#170586 myheritage.gr
#170587 policenews.eu News
#170588 prepaytec.com
#170589 sticky.gr
#170590 winmasters.com
#170591 freshsparks.com
#170592 pu.edu.np
#170593 asdaadubai.com
#170594 zoutons.ae
#170595 trafficbot.co
#170596 edmontonsun.com
#170597 tesera.ru
#170598 house-villa.ru
#170599 elcomsoft.com
#170600 truehostcloud.com
#170601 dijitalbasin.com
#170602 fenbilimleri.com
#170603 tvnobar.com
#170604 85jtg3.com
#170605 kinovod.net
#170606 sba.co.ug
#170607 brianvazgamespc.blogspot.com Blogs
#170608 bersosial.com
#170609 al-arafahbank.com Banks
#170610 2do2go.ru
#170611 metodisty.ru
#170612 online-shop2019.ru Online Shopping
#170613 vsedz.ru
#170614 17yyba.com
#170615 adpo.edu.ru
#170616 cntiprogress.ru
#170617 xn----dtbhthpdbkkaet.xn--p1ai
#170618 xn--80ajghhoc2aj1c8b.xn--p1ai
#170619 edlumina.com
#170620 marketingwit.com
#170621 porn-image-xxx.com Adult
#170622 tipsbulletin.com
#170623 creativeguerrillamarketing.com
#170624 hrblock.in
#170625 uploadboy.me
#170626 entornointeligente.com
#170627 kino-24.com
#170628 adamas.ru
#170629 bookmaker-ratings.com.ua
#170630 gsm-social.com
#170631 football.by
#170632 9tana.com
#170633 hallyukstar.com
#170634 nma6.go.th
#170635 positioningmag.com
#170636 npauctions.com
#170637 lastminuteengineers.com
#170638 mediadabali.com
#170639 bestdataresu1ts.com
#170640 dramago.com
#170641 ptepractice.com
#170642 web-savvy-marketing.com
#170643 happy-or-not.com
#170644 hupso.com
#170645 lapti.tv
#170646 edlio.com
#170647 myfixguide.com
#170648 hentaiprn.com
#170649 huree.mn
#170650 healtheuropa.eu
#170651 aveal.com.ua
#170652 spzh.news News
#170653 gouv.ga
#170654 advocare.com
#170655 xrpl.org
#170656 scilab.org
#170657 hazi-hinam.co.il
#170658 528go.com
#170659 angular.github.io
#170660 auntymay.com
#170661 bypassfrpfiles.com
#170662 carewellhealth.com
#170663 cbkassociates.com
#170664 dkhitmedia.com
#170665 examiner.com.au Exam & Results
#170666 jbc-s.net
#170667 mmtimespecialnews.com News
#170668 myancloud.net
#170669 myanmarbooks.info
#170670 myanmarmp3.net
#170671 oobadeweb.azurewebsites.net
#170672 poppinnew.com
#170673 prepaidcard.com.mm
#170674 pyidaungsu.hluttaw.mm
#170675 sgshop.com.mm Online Shopping
#170676 shwerooms.com
#170677 thuraswiss.com
#170678 travelwithpete.com Tours & Travels
#170679 uukk959.com
#170680 vipking.news News
#170681 waybill.work
#170682 webrtc.org
#170683 l-com.com
#170684 uiplace.com
#170685 youtubekids.com Videos
#170686 own-business-day.com
#170687 unifore.net
#170688 clairegothie.com
#170689 green-red.com
#170690 vidri.com.sv
#170691 processexam.com Adult
#170692 arbnews.net News
#170693 sorabel.com
#170694 5lb.eu
#170695 abitat.com.mx
#170696 addictware.com.mx
#170697 cesarsanchez.mx
#170698 cloud-creativedk.com
#170699 comexus.org.mx
#170700 cuartopodermichoacan.com
#170701 cursoserelis.com
#170702 demorelos.com
#170703 dfacture.com
#170704 direcciontransitojuchitan.gob.
#170705 farmaleal.myshopify.com Online Shopping
#170706 foleys.com.mx
#170707 foro-ciudad.com
#170708 heyhola.me
#170709 holdworkshop.com Online Shopping
#170710 ilusion.com
#170711 imagina.tv
#170712 infox.mx
#170713 interconceptoeditorial.com
#170714 liceotulyehualco.com
#170715 logisticasilsa.com.mx
#170716 pbteen.com.mx
#170717 pronapresa.myshopify.com Online Shopping
#170718 queretaro24-7.com
#170719 sotomora.es
#170720 storefront.com
#170721 sttc.com
#170722 thelevelmedia.com
#170723 torreprisma.com
#170724 trajeshidalgo.com
#170725 tuinterfaz.mx
#170726 unionofrealestateprofessionals
#170727 upemor.edu.mx
#170728 williams-sonoma.com.mx
#170729 worldjob.or.kr Jobs
#170730 zankyou.info
#170731 renishaw.com
#170732 khcc.jo
#170733 nuevodiariodesalta.com.ar
#170734 glodls.to
#170735 pix4d.com
#170736 useful-deals.com
#170737 youthvillage.co.za
#170738 hablemosdemitologias.com
#170739 informatee.com
#170740 mensajesdecumpleanoss.com
#170741 trucoteca.com
#170742 unitedexplanations.org
#170743 aeropaca.org
#170744 epnet.com
#170745 falstad.com
#170746 rdtcdn.com
#170747 codeswodes.com
#170748 behsun.school Education
#170749 blograz.ir Blogs
#170750 delsukhtehgan.ir
#170751 eshia.ir
#170752 host97.net
#170753 netbarg.org
#170754 noornet.net
#170755 skillearn.ir
#170756 snowa.ir
#170757 suncode.ir
#170758 iso27001security.com
#170759 deshaya.lk
#170760 heinze.de
#170761 cyberdefensemagazine.com
#170762 icratek.com.tr
#170763 printerofset.com.tr
#170764 ziraatkatilim.com.tr
#170765 excelsiorgama.com
#170766 gpro-strategy.net
#170767 meridianobet.net
#170768 notifalcon.com
#170769 rentahouse.com.ve
#170770 zoomenvios.com
#170771 akubebas.com
#170772 topradio.me
#170773 onlineconvert.com
#170774 firstdns.net
#170775 officekala.com
#170776 mawazin.net
#170777 mmasilver.com
#170778 asort.com
#170779 astrologyoffline.com
#170780 cableguyapp.com
#170781 classboat.com
#170782 jammukashmir.com
#170783 jcirajkot.com
#170784 jimare.com
#170785 No Content
#170786 ladea.com.au
#170787 ontargetrange.com
#170788 rojgarbharat.info
#170789 round.glass
#170790 securehostdns.com
#170791 snugsquare.com
#170792 traversetelecom.com
#170793 sagligabiradim.com
#170794 superbahis553.com
#170795 tssandycateup.com
#170796 idshow.com.tw
#170797 goodyear.eu
#170798 nutrition-and-you.com
#170799 afp.gov.au government Related
#170800 simplysinova.com
#170801 midiplex.net
#170802 agro-market.net
#170803 adayinourshoes.com
#170804 analyticaltechnologies.com.sg
#170805 hpooya.com
#170806 likesrock.com
#170807 barevblog.com Blogs
#170808 senditoo.com
#170809 patee.ru
#170810 goherbalife.com
#170811 fluidampr.com
#170812 socialmediavalue.io
#170813 weeklyprizewinner.org
#170814 xavier.edu
#170815 foody.com.cy
#170816 blogvporn.com Adult
#170817 minecraft.com
#170818 responsivemiracle.com
#170819 balkanjizz.com
#170820 climate-kic.org
#170821 ff.com
#170822 worldluxrealty.com
#170823 foodandhealth.ru
#170824 canon.fr
#170825 clubdom2.com
#170826 rubiasxxx.net Adult
#170827 streetsblog.org Blogs
#170828 detstrana.ru
#170829 kidside.ru
#170830 earnsites.ir
#170831 farnaam.net
#170832 freakmasters.com
#170833 hanaamir.com
#170834 idea-soft.ir
#170835 iraniangraphic.com
#170836 iranpejvak.com
#170837 irmeta.com
#170838 kandoocn.com
#170839 maxtel-shop.com Online Shopping
#170840 payam1346.ir
#170841 widemusic.ir
#170842 edgekey.net
#170843 accesoatt.com
#170844 astronomiaenpuertorico.com
#170845 infopaginas.com
#170846 sportlio.com
#170847 youngsexhd.net Adult
#170848 animebatchs.com
#170849 bkpm.go.id
#170850 startupfashion.com
#170851 a-zgsm.com
#170852 aamaadmiparty.org
#170853 alfa.com
#170854 alubhujia.com
#170855 americanexpress.co.in
#170856 archipassport.com
#170857 arihantwebtech.com
#170858 aryavysyamatrimony.com
#170859 atherenergy.com
#170860 berkshirehathaway.com
#170861 billi4you.in
#170862 bitsathy.ac.in
#170863 bizkonnect.com
#170864 bizz-directory.com
#170865 careerage.com
#170866 codesria.org
#170867 copybook.com
#170868 crisil.com
#170869 cybercrime.gov.in government Related
#170870 daduru.com
#170871 dbhpscentral.org
#170872 delclassified.com
#170873 delhiprinter.com
#170874 delhismartcities.com
#170875 dialme24.in
#170876 digitaladworks.com
#170877 digitalmarketing-wiki.com
#170878 directorycodes.com
#170879 dlf.in
#170880 dmsn.in
#170881 dream11indian.com
#170882 eclature.com
#170883 edmhunters.com
#170884 eduniv.in
#170885 eicmai.org
#170886 ethosdental.co.in
#170887 everythingallowed.com
#170888 exppresscarwash.com
#170889 financial-hub.net
#170890 fionadates.com
#170891 fortunehotels.in Hotels, Resorts & Food
#170892 freearticlesworld.com
#170893 geniusconsultant.com
#170894 globalfirstpage.com
#170895 gorelations.com
#170896 gripinternational.in
#170897 healthymind.xyz
#170898 highnoteperformance.com
#170899 hindirasayan.com
#170900 humaneditedlistings.com
#170901 ifbserv.com
#170902 imseo.info Search Engine optimization
#170903 imsinternal.com
#170904 indiamapia.com
#170905 intaspharma.com
#170906 janakiweb.wordpress.com Blogs
#170907 jobapply.in Jobs
#170908 jsboutique.com
#170909 karresults.nic.in Exam & Results
#170910 khetigaadi.com
#170911 lawyered.in
#170912 learningcatalyst.in
#170913 lineshjose.com
#170914 linkextras.com
#170915 linksontherise.com
#170916 linksplaced.com
#170917 listingsmaintained.com
#170918 loverlovely.com
#170919 mahindracareers.com
#170920 morestore.com
#170921 moviespur.org
#170922 mtrfoods.com
#170923 mywebfind.org
#170924 navhindtimes.in
#170925 ncert.org.in
#170926 newsbrig.com News
#170927 nitin-gupta.com
#170928 odmt.in
#170929 oftenzone.com
#170930 online-websites-directory.com
#170931 oxiapps.com
#170932 peopleworks.ind.in
#170933 perfectbodytype.com
#170934 piramalswasthya.org
#170935 pixel-studios.com
#170936 pramati.com
#170937 prpsms.co.in
#170938 purepassion.in
#170939 qcin.org
#170940 railenquiry.in
#170941 rfandl.com
#170942 rishabh.co.in
#170943 ruce.org
#170944 satiengg.in
#170945 scholarsmojo.com
#170946 servicesupgraded.com
#170947 servicesutra.com
#170948 siu.edu.in
#170949 sivaindia.com
#170950 soniadogra.com
#170951 spartanprogear.com
#170952 srivijayadurgahospital.com
#170953 srmap.edu.in
#170954 stashfin.com
#170955 stillsolution.com
#170956 storybookmarking.com
#170957 stsholidays.com
#170958 supertronindia.com
#170959 swapon.co.in
#170960 sweetcouch.com
#170961 sxccal.edu
#170962 techblogng.net Blogs
#170963 teckum.com
#170964 tendertiger.com
#170965 the6track.com
#170966 themommyonboard.wordpress.com Blogs
#170967 thetradefinder.co.uk
#170968 theweddingbrigade.com
#170969 tolleydesign.com
#170970 tpcglobe.com
#170971 trafigura.com
#170972 tsche.ac.in
#170973 upboardsolutions.com
#170974 vajratranspower.com
#170975 vegahelmet.com
#170976 vineretail.com
#170977 wbnsou.ac.in
#170978 webcluesinfotech.com
#170979 writerscafe.org
#170980 zaykarecipes.com
#170981 beztabu.net
#170982 minova.com.ua
#170983 easiershoping.myshopify.com Online Shopping
#170984 flyingcarpetholidays.com
#170985 ipi.gov.eg government Related
#170986 xbnat.com
#170987 dingo-pictures.de
#170988 dot.gov.au government Related
#170989 komo.digital
#170990 kult.com.au
#170991 mycustomtshirts.com.au
#170992 nasdaqomx.com
#170993 s9000007.wordpress.com Blogs
#170994 stake-acp.netlify.com
#170995 visioncreatives.com.au
#170996 yahmarketing.com.au
#170997 catchy.com
#170998 p30hosting.com Domains & Hosting
#170999 poshtibanservice.com
#171000 afoto4u.com
«PREV Next»
page no. 171Out of 949 Pages